SARS-CoV-2 (COVID-19) S2 Recombinant Protein Cat. No.: 10-077

Availability: In stock

$0.00

No Image

 Price Options

$0.00
psi-iconSpecifications
SPECIES:SARS-CoV-2
SOURCE SPECIES:HEK293 cells
SEQUENCE:SVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTEC SNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSK PSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYT SALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKI QDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDR LITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSA PHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIIT TDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVV NIQKEIDRLNEVAKNLNESLIDLQELGKYEQ
TESTED APPLICATIONS:ELISA
APPLICATIONS:ELISA
psi-iconProperties
PURITY:>95% by SDS Page
PREDICTED MOLECULAR WEIGHT:The predicted molecular mass is ~60 kDa
PHYSICAL STATE:Liquid
BUFFER:This recombinant protein is aseptically packaged and formulated in 0.01 M phosphate buffered saline (PBS) pH 7.2 - 7.4, 150 mM NaCl with no carrier protein, potassium, calcium or preservatives added.
STORAGE CONDITIONS:This recombinant protein may be stored as received at 2-8˚C for up to one month. For longer term storage, aseptically aliquot in working volumes without diluting and store at -80˚C. Avoid Repeated Freeze Thaw Cycles.
psi-iconAdditional Info
ACCESSION NO.:QHD43416.1
GENE ID:1791269090
psi-iconBackground and References
BACKGROUND:Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), the causative agent of coronavirus disease 2019 (COVID-19), is an enveloped, single-stranded, positive-sense RNA virus that belongs to the Coronaviridae family 1. The SARS-CoV-2 genome, which shares 79.6% identity with SARS-CoV, encodes four essential structural proteins: the spike (S), envelope (E), membrane (M), and nucleocapsid protein (N) 2. The S protein is a transmembrane, homotrimeric, class I fusion glycoprotein that mediates viral attachment, fusion, and entry into host cells 3. Each ~180 kDa monomer contains two functional subunits, S1 (~700 a.a) and S2 (~600 a.a), that mediate viral attachment and membrane fusion, respectively. In both SARS-CoV and SARS-CoV-2, the receptor-binding domain (RBD) is at the C-terminus of S1 and binds to the angiotensin-converting enzyme 2 (ACE2) receptor on host cells 3-5. Following receptor binding, S1 destabilizes, and TMPRSS2 cleaves S2, which undergoes a pre- to post-fusion conformation transition, allowing for membrane fusion 4, 6. Unlike S1, S2 is conserved among coronaviruses, and the S2 of SARS-CoV-2 shares 88% sequence identity with SARS-CoV, suggesting that broadly neutralizing antibodies targeting S2 may cross-react with both viruses 4.
REFERENCES:1) Zhou, P., Yang, X., Wang, X. et al. Nature 579, 270–273. 2020.
2) Wu, F., Zhao, S., Yu, B. et al. Nature 579, 265–269. 2020.
3) Wrapp D, Wang N, Corbett KS, et al. bioRxiv. 2020.02.11.944462. 2020.
4) Walls AC, Park YJ, Tortorici MA, et al. Cell. 181(2):281-292.e6. 2020

FOR RESEARCH USE ONLY.

For additional information, visit ProSci's Terms & Conditions Page.