SARS-CoV-2 (COVID-19) S1 Recombinant Protein Cat. No.: 10-076

Availability: In stock

$0.00

No Image

 Price Options

$0.00
psi-iconSpecifications
SPECIES:SARS-CoV-2
SOURCE SPECIES:HEK293 cells
SEQUENCE:VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSG TNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKV CEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQG NFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLAL HRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKC TLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISN CVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKI ADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQA GSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKST NLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITP CSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQT RAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPGSAS
TESTED APPLICATIONS:ELISA
APPLICATIONS:ELISA
psi-iconProperties
PURITY:>95% by SDS Page
PREDICTED MOLECULAR WEIGHT:The predicted molecular mass is ~77 kDa.
PHYSICAL STATE:Liquid
BUFFER:This recombinant protein is aseptically packaged and formulated in 0.01 M phosphate buffered saline (PBS) pH 7.2 - 7.4, 150 mM NaCl with no carrier protein, potassium, calcium or preservatives added.
CONCENTRATION:0.5 mg/ml
STORAGE CONDITIONS:This recombinant protein may be stored as received at 2-8˚C for up to one month. For longer term storage, aseptically aliquot in working volumes without diluting and store at -80˚C. Avoid Repeated Freeze Thaw Cycles.
psi-iconAdditional Info
ACCESSION NO.:QHD43416.1
GENE ID:1791269090
psi-iconBackground and References
BACKGROUND:The SARS-CoV-2 Spike (S) Protein consists of the S1 and S2 domains. The S1 subunit contains the N-terminal domain (NTD) and receptor-binding domain (RBD). The S1 subunit recognizes and binds to angiotensin-converting enzyme 2 (ACE2) receptors on target cells through the RBD portion, and subsequent conformational changes in S2 allow for fusion between the viral envelope and host cell membrane. SARS-CoV-2 is closely related to the SARS virus, which was first identified in 2002-20031. Both SARS-CoV and SARS-CoV-2 utilize the ACE2 cell receptor to gain entry into cells, with SARS-CoV-2 binding with higher affinity2. Vaccine and therapeutic development are targeting portions of the spike protein, including the S1 portion3.
REFERENCES:1) Quinlan et al. bioRxiv:2020.
2) Wrapp et al. Science: 2020.
3) Tai et al. Nature: 2020.

FOR RESEARCH USE ONLY.

For additional information, visit ProSci's Terms & Conditions Page.