• Skip to main content
  • Skip to footer
Close Hamburger Menu Close Hamburger Menu
  • New / Featured Products
  • Advanced Validation
  • Support
  • Promotions
  • Loyalty Program
  • Blog
  • About Us
  • ProSci Distributors

ProSci Incorporated

  • (888) 513-9525
  • Search Icon Open Search Box
  • Sign In
  • Cart Icon
  • Open Hamburger Menu Open Hamburger Menu
  • COVID-19
  • Products
    • Primary Antibodies
    • Secondary Antibodies
    • More
      • Antibody Beads
      • Chemical
      • Control Antibodies
      • Detection Sets
      • Drug Analogues
      • Immunoblots
      • Lysates
      • Peptides
      • Pseudoviruses
      • Reagents
      • Recombinant Proteins
      • Slides
  • Custom Services
  • Applications & Techniques
  • Contact
  • New / Featured Products
  • Advanced Validation
  • Support
  • Promotions
  • Loyalty Program
  • Blog
  • About Us
  • ProSci Distributors
Home / Chemical / VIP (human, mouse, rat) . AcOH [RLF-100]
VIP (human, mouse, rat) . AcOH [RLF-100]
VIP (human, mouse, rat) . AcOH [RLF-100]

VIP (human, mouse, rat) . AcOH [RLF-100]

CATALOG NUMBER: 11-083
  • Size: 5 mg

Specifications

  • PREDICTED MOLECULAR WEIGHT: 3325.8 . 60.0 / sequence: H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2
  • Formula: C147H238N44O42S . C2H4O2
  • CAS: 444827-29-5 | 40077-57-4 (free base)
  • Solubility: Soluble in water or aqueous solution (1% AcOH) (1mg/ml).
  • InChi Key: ZPFJSONBPCXUTA-KAZBKGEHSA-N
  • Smiles: O=C([C@H]([C@@H](C)CC)NC([C@H](CO)NC([C@H](CC(N)=O)NC([C@H](CC(C)C)NC([C@H](CC(C=C1)=CC=C1O)NC([C@H](CCCCN)NC([C@H](CCCCN)NC([C@H](C(C)C)NC([C@H](C)NC([C@H](CCSC)NC([C@H](CCC(N)=O)NC([C@H](CCCCN)NC(C(CCCNC(N)=N)NC([C@H](CC(C)C)NC([C@H](CCCNC(N)=N)NC([C@H]([C@@H](C)O)NC([C@H](CC(C=C2)=CC=C2O)NC([C@H](CC(N)=O)NC([C@H](CC(O)=O)NC([C@H]([C@@H](C)O)N([H])C([C@H](CC3=CC=CC=C3)NC([C@H](C(C)C)NC([C@H](C)NC([C@H](CC(O)=O)NC([C@H](CO)NC([C@H](CC4=CN=CN4)N)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)N[C@H](C(N[C@H](C(N)=O)CC(N)=O)=O)CC(C)C.CC(O)=O

Properties

  • PURITY: greater than or equal to 98% (HPLC)
  • PHYSICAL STATE: Lyophilized
  • STORAGE CONDITIONS: Short Term Storage: +4C. Long Term Storage: -20C. Handling Advice: Keep cool and dry. Use/Stability: Stable for at least 2 years after receipt when stored at -20C.

Additional Info

  • ADDITIONAL NAMES: Aviptadil; HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2; Vasoactive Intestinal Peptide; Vasoactive Intestinal Octacosapeptide

Background

  • Vasoactive intestinal peptide (VIP) is a 28 aa peptide that belongs to secretin-glucagon-CRF superfamily, the ligand of class II G protein-coupled receptors subclass B1. VIP binds to the receptors VPAC1, VPAC2 and with less sensitivity to PAC1, which trigger a G-α-mediated signaling cascade, eventually activating adenyl cyclase leading to increases in cAMP and PKA. The PKA then activates other intracellular signaling pathways like the phosphorylation of CREB and other transcriptional factors. The VIP receptors are widely expressed in brain, liver, lung, pancreas, skeletal muscle, heart, kidney, adipose tissue, testis and stomach and also abundantly in immune cells. Although first identified in the intestinal tract, VIP is now known to be produced throughout the body, but primarily concentrated in the lungs, bound to the alveolar type II cell type, which is critical for the transmission of oxygen to the body.The widespread distribution of VIP correlates with its involvement in a wide variety of biological activities including vasodilation, bronchodilation, hyperglycaemia, neuroprotection, inflammation, autoimmunity, cancer and hormonal regulation. VIP has multiple physiological and pathological effects on development, growth, and the control of neuronal, epithelial and endocrine cell functions that in turn regulate ion secretion, nutrient absorption, gut motility, glycemic control, carcinogenesis, immune responses and circadian rhythms. VIP is a antiproliferative, anti-inflammatory and immune-regulatory peptide. As anti-inflammatory agent it acts by inhibiting phagocytic activity, free radical production, adherence and migration of macrophages. It reduces the production of inflammatory cytokines (TNF-α, IL-12, IL-6 and IL-1β) and various chemokines and downregulates the expression of inducible nitric oxide synthase.VIP is expressed in airway epithelial cells, secretory glands, immune and inflammatory cells. It functions as a neuroendocrine hormone and putative neurotransmitter. It stimulates neuronal survival and modulates glycogen metabolism. VIP blocks mitogen-activated proliferation of T cells by preventing interleukin-2 production. It promotes electrolyte secretion and provides protection against oxidant injury. VIP has especially potent anti-inflammatory activity in animal models of respiratory distress, acute lung injury and inflammation. VIP has been used in clinical trials for sarcoidosis, pulmonary fibrosis, asthma/allergy, and pulmonary hypertension.VIP (RLF-100; Aviptadil) provides rapid respiratory failure reduction in clinically ill patients with COVID-19 and blocks replication of the SARS-CoV-2 virus in human lung cells and monocytes. Therefore it is being investigated in clinical trials for the treatment of Acute Respiratory Distress Syndrome (ARDS) in COVID-19. COVID-19-related death is primarily caused by respiratory failure induced by early viral infection of the alveolar type 2 cells. These cells are known to have angiotensin-converting enzyme 2 (ACE2) receptors at high levels, which serve as the route of entry for the SARS-CoV-2 into the cells. The same type 2 alveolar cells have high concentrations of VIP receptors on their cell surfaces giving rise to the hypothesis that VIP could specifically protect these cells from injury. Interestingly alveolar type 2 cells produce a surfactant that coats the lung and is essential for oxygen exchange and RLF-100 specifically targets these vulnerable alveolar type 2 cells.

Disclaimer

  • FOR RESEARCH USE ONLY
    For additional information, visit ProSci's Terms & Conditions Page.
  • Disclaimer: This product is for research use only.

CATALOG NUMBER: 11-083

  • Size: 5 mg
  • List Price: $265.00
Datasheet
Shipping Info

$65 Standard Overnight flat rate for as many products shipped within the United States.

$35 Dry Ice Shipment fee may be required on some items.

Note: Online orders only accepted for shipment within the USA. Click here for the list of international distributors.

Menu

  • Primary Antibodies
  • Secondary Antibodies
  • Recombinant Proteins
  • Applications & Techniques
  • Support
  • Loyalty Program
  • Blog
  • Promotions
  • About Us
  • ProSci Distributors
Custom Antibody Services

Contact

12170 Flint Place
Poway, CA 92064, USA

Phone:   +1 (888) 513-9525
Local:    +1 (858) 513-2638
Fax:       +1 (858) 513-2692

customercare@prosci-inc.com
techsupport@prosci-inc.com

Follow

  • Facebook
  • Twitter
  • LinkedIn
  • Pinterest
  • Instagram
Copyright © 2022 ProSci Incorporated | All Rights Reserved | Terms & Conditions | Privacy Policy | Accessibility Feedback | Design by TinyFrog Technologies
We use cookies on our website to give you the most relevant experience by remembering your preferences and repeat visits. By clicking “Accept”, you consent to the use of cookies.
Accept Reject
Manage consent

Privacy Overview

This website uses cookies to improve your experience while you navigate through the website. Out of these, the cookies that are categorized as necessary are stored on your browser as they are essential for the working of basic functionalities of the website. We also use third-party cookies that help us analyze and understand how you use this website. These cookies will be stored in your browser only with your consent. You also have the option to opt-out of these cookies. But opting out of some of these cookies may affect your browsing experience.
Necessary
Always Enabled
Necessary cookies are absolutely essential for the website to function properly. These cookies ensure basic functionalities and security features of the website, anonymously.
CookieDurationDescription
cookielawinfo-checbox-analytics11 monthsThis cookie is set by GDPR Cookie Consent plugin. The cookie is used to store the user consent for the cookies in the category "Analytics".
cookielawinfo-checbox-functional11 monthsThe cookie is set by GDPR cookie consent to record the user consent for the cookies in the category "Functional".
cookielawinfo-checbox-others11 monthsThis cookie is set by GDPR Cookie Consent plugin. The cookie is used to store the user consent for the cookies in the category "Other.
cookielawinfo-checkbox-necessary11 monthsThis cookie is set by GDPR Cookie Consent plugin. The cookies is used to store the user consent for the cookies in the category "Necessary".
cookielawinfo-checkbox-performance11 monthsThis cookie is set by GDPR Cookie Consent plugin. The cookie is used to store the user consent for the cookies in the category "Performance".
viewed_cookie_policy11 monthsThe cookie is set by the GDPR Cookie Consent plugin and is used to store whether or not user has consented to the use of cookies. It does not store any personal data.
Functional
Functional cookies help to perform certain functionalities like sharing the content of the website on social media platforms, collect feedbacks, and other third-party features.
Performance
Performance cookies are used to understand and analyze the key performance indexes of the website which helps in delivering a better user experience for the visitors.
Analytics
Analytical cookies are used to understand how visitors interact with the website. These cookies help provide information on metrics the number of visitors, bounce rate, traffic source, etc.
Advertisement
Advertisement cookies are used to provide visitors with relevant ads and marketing campaigns. These cookies track visitors across websites and collect information to provide customized ads.
Others
Other uncategorized cookies are those that are being analyzed and have not been classified into a category as yet.
SAVE & ACCEPT