• Skip to main content
  • Skip to footer
Close Hamburger Menu Close Hamburger Menu
  • New / Featured Products
  • Advanced Validation
  • Support
  • Promotions
  • Loyalty Program
  • Blog
  • About Us
  • ProSci Distributors

ProSci Incorporated

  • (888) 513-9525
  • Search Icon Open Search Box
  • Sign In
  • Cart Icon
  • Open Hamburger Menu Open Hamburger Menu
  • COVID-19
  • Products
    • Primary Antibodies
    • Secondary Antibodies
    • More
      • Antibody Beads
      • Control Antibodies
      • Detection Sets
      • Immunoblots
      • Lysates
      • Peptides
      • Reagents
      • Recombinant Proteins
      • Slides
      • Chemical
  • Custom Services
  • Applications & Techniques
  • Contact
  • New / Featured Products
  • Advanced Validation
  • Support
  • Promotions
  • Loyalty Program
  • Blog
  • About Us
  • ProSci Distributors
Home / By Source / Human Cells / SARS-CoV-2 (COVID-19) NTD Recombinant Protein
SARS-CoV-2 (COVID-19) NTD Recombinant Protein
SARS-CoV-2 (COVID-19) NTD Recombinant Protein

SARS-CoV-2 (COVID-19) NTD Recombinant Protein

CATALOG NUMBER: 10-079
  • Tested Applications: E
  • Size: 0.1 mg

Specifications

  • SPECIES: SARS-CoV-2
  • SOURCE SPECIES: HEK293 cells
  • RECOMBINANT PROTEIN SEQUENCE: VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKS
  • TESTED APPLICATIONS: E
  • APPLICATION NOTE: ELISA
  • PREDICTED MOLECULAR WEIGHT: The predicted molecular mass is ~36 kDa.

Properties

  • PURITY: >95% by SDS Page
  • PHYSICAL STATE: Liquid
  • BUFFER: This recombinant protein is aseptically packaged and formulated in 0.01 M phosphate buffered saline (PBS) pH 7.2 - 7.4, 150 mM NaCl with no carrier protein, potassium, calcium or preservatives added.
  • CONCENTRATION: 0.5 mg/ml
  • STORAGE CONDITIONS: This recombinant protein may be stored as received at 2-8°C for up to one month. For longer term storage, aseptically aliquot in working volumes without diluting and store at -80°C. Avoid Repeated Freeze Thaw Cycles.

Additional Info

  • Protein Accession Number: QHD43416.1
  • NCBI GENE ID NUMBER: 1791269090

Background

  • Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), the causative agent of coronavirus disease 2019 (COVID-19), is an enveloped, single-stranded, positive-sense RNA virus that belongs to the Coronaviridae family 1. The SARS-CoV-2 genome, which shares 79.6% identity with SARS-CoV, encodes four essential structural proteins: the spike (S), envelope (E), membrane (M), and nucleocapsid protein (N) 2. The S protein is a transmembrane, homotrimeric, class I fusion glycoprotein that mediates viral attachment, fusion, and entry into host cells 3. Each ~180 kDa monomer contains two functional subunits, S1 (~700 a.a) and S2 (~600 a.a), that mediate viral attachment and membrane fusion, respectively. S1 contains two major domains, the N-terminal (NTD) and C-terminal domains (CTD). In both SARS-CoV and SARS-CoV-2, the CTD contains the receptor-binding domain (RBD), which binds to the angiotensin-converting enzyme 2 (ACE2) receptor on host cells3-5. The NTD of SARS-CoV-2 does not bind to ACE26, and the function of NTD in SARS-CoV-2 infection is not well understood. In other CoVs, the NTD may promote attachment by binding to sugar moieties7 and might play a role in the conformational change of S2 required for membrane fusion8. While most neutralizing antibodies target the RBD domain and block receptor binding, potent neutralizing antibodies targeting NTD were isolated from convalescent COVID19 patients9, identifying the NTD as an attractive candidate for vaccines and therapeutics. In addition, the NTD is a promising antigen for diagnostic tests, as there is only 53.5% homology between the NTD of SARS-CoV-2 and SARS-CoV10.
  • 1: Zhou, P., Yang, X., Wang, X. et al. Nature 579, 270–273. 2020.
  • 2: Wu, F., Zhao, S., Yu, B. et al. Nature 579, 265–269. 2020.
  • 3: Wrapp D, Wang N, Corbett KS, et al. bioRxiv. 2020.
  • 4: Walls AC, Park YJ, Tortorici MA, et al. Cell. 181(2):281-292.e6. 2020.

Disclaimer

  • FOR RESEARCH USE ONLY
    For additional information, visit ProSci's Terms & Conditions Page.
  • Disclaimer: Optimal dilutions/concentrations should be determined by the end user. The information provided is a guideline for product use. This product is for research use only.

CATALOG NUMBER: 10-079

  • Size: 0.1 mg
  • List Price: $590.00
Datasheet
Shipping Info

$65 Standard Overnight flat rate for as many products shipped within the United States.

$35 Dry Ice Shipment fee may be required on some items.

Note: Online orders only accepted for shipment within the USA. Click here for the list of international distributors.

New & Featured Products
SARS-CoV-2 Omicron BA.1 Variant Pseudovirus
SARS-CoV-2 Omicron BA.1 Variant Pseudovirus

CATALOG NUMBER: 95-201

SARS-CoV-2 WT Pseudovirus
SARS-CoV-2 WT Pseudovirus

CATALOG NUMBER: 95-200

SARS-CoV-2 (COVID-19) Spike Q493R G496S Q498R N501Y Y505H Antibody (Omicron)
SARS-CoV-2 (COVID-19) Spike Q493R G496S Q498R N501Y Y505H Antibody (Omicron)

CATALOG NUMBER: 9805

Menu

  • Primary Antibodies
  • Secondary Antibodies
  • Recombinant Proteins
  • Applications & Techniques
  • Support
  • Loyalty Program
  • Blog
  • Promotions
  • About Us
  • ProSci Distributors
Custom Antibody Services

Contact

12170 Flint Place
Poway, CA 92064, USA

Phone:   +1 (888) 513-9525
Local:    +1 (858) 513-2638
Fax:       +1 (858) 513-2692

customercare@prosci-inc.com
techsupport@prosci-inc.com

Follow

  • Facebook
  • Twitter
  • LinkedIn
  • Pinterest
  • Instagram
Copyright © 2022 ProSci Incorporated | All Rights Reserved | Terms & Conditions | Privacy Policy | Accessibility Feedback | Design by TinyFrog Technologies
We use cookies on our website to give you the most relevant experience by remembering your preferences and repeat visits. By clicking “Accept”, you consent to the use of cookies.
Accept Reject
Manage consent

Privacy Overview

This website uses cookies to improve your experience while you navigate through the website. Out of these, the cookies that are categorized as necessary are stored on your browser as they are essential for the working of basic functionalities of the website. We also use third-party cookies that help us analyze and understand how you use this website. These cookies will be stored in your browser only with your consent. You also have the option to opt-out of these cookies. But opting out of some of these cookies may affect your browsing experience.
Necessary
Always Enabled
Necessary cookies are absolutely essential for the website to function properly. These cookies ensure basic functionalities and security features of the website, anonymously.
CookieDurationDescription
cookielawinfo-checbox-analytics11 monthsThis cookie is set by GDPR Cookie Consent plugin. The cookie is used to store the user consent for the cookies in the category "Analytics".
cookielawinfo-checbox-functional11 monthsThe cookie is set by GDPR cookie consent to record the user consent for the cookies in the category "Functional".
cookielawinfo-checbox-others11 monthsThis cookie is set by GDPR Cookie Consent plugin. The cookie is used to store the user consent for the cookies in the category "Other.
cookielawinfo-checkbox-necessary11 monthsThis cookie is set by GDPR Cookie Consent plugin. The cookies is used to store the user consent for the cookies in the category "Necessary".
cookielawinfo-checkbox-performance11 monthsThis cookie is set by GDPR Cookie Consent plugin. The cookie is used to store the user consent for the cookies in the category "Performance".
viewed_cookie_policy11 monthsThe cookie is set by the GDPR Cookie Consent plugin and is used to store whether or not user has consented to the use of cookies. It does not store any personal data.
Functional
Functional cookies help to perform certain functionalities like sharing the content of the website on social media platforms, collect feedbacks, and other third-party features.
Performance
Performance cookies are used to understand and analyze the key performance indexes of the website which helps in delivering a better user experience for the visitors.
Analytics
Analytical cookies are used to understand how visitors interact with the website. These cookies help provide information on metrics the number of visitors, bounce rate, traffic source, etc.
Advertisement
Advertisement cookies are used to provide visitors with relevant ads and marketing campaigns. These cookies track visitors across websites and collect information to provide customized ads.
Others
Other uncategorized cookies are those that are being analyzed and have not been classified into a category as yet.
SAVE & ACCEPT