• Skip to main content
  • Skip to footer
Close Hamburger Menu Close Hamburger Menu
  • New / Featured Products
  • Advanced Validation
  • Support
  • Promotions
  • Loyalty Program
  • Blog
  • About Us
  • ProSci Distributors

ProSci Incorporated

  • (888) 513-9525
  • Search Icon Open Search Box
  • Sign In
  • Cart Icon
  • Open Hamburger Menu Open Hamburger Menu
  • COVID-19
  • Products
    • Primary Antibodies
    • Secondary Antibodies
    • More
      • Antibody Pairs
      • Biosimilars
      • Chemical
      • Control Antibodies
      • Detection Sets
      • Functional Antibodies
      • Immunoblots
      • Lysates
      • Peptides
      • Pseudoviruses
      • Recombinant Proteins
      • Slides
  • Custom Services
  • Applications & Techniques
  • Contact
  • New / Featured Products
  • Advanced Validation
  • Support
  • Promotions
  • Loyalty Program
  • Blog
  • About Us
  • ProSci Distributors
Home / bacteria / MERS Coronavirus Membrane (HSZ-Cc) Recombinant Protein
MERS Coronavirus Membrane (HSZ-Cc) Recombinant Protein
MERS Coronavirus Membrane (HSZ-Cc) Recombinant Protein

MERS Coronavirus Membrane (HSZ-Cc) Recombinant Protein

CATALOG NUMBER: 20-225
  • Size: 0.1 mg
Powered by Bioz

Specifications

  • SPECIES: MERS
  • SOURCE SPECIES: bacteria
  • RECOMBINANT PROTEIN SEQUENCE: Native Sequence:
    MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMSNMTQLTEAQIIAIIKDWNFAWSLIFLLITIVLQYGYPSRSMTVYVFKMFVLWLLWPSSMALSIFSAIYPIDLASQIISGIVAAVSAMMWISYFVQSIRLFMRTGSWWSFNPETNCLLNVPIGGTIVVRPLVEDSTSVTAVVTNGHLKMAGMHFGACDYDRLPNEVTVAKPNVLIALKMVKRQSYGTNSGVAIYHRYKAGNYRSPPITADIELALLRA

    Amino acids M1 – A219 (end).
    Residue M232 of the fusion protein is equivalent to M1 of the native enzyme. The GST tag is located at residues 1 – 220.

    Protease Cleavage:
    PreScission (LEVLFQGP) residues 221 - 228
  • FUSION TAG: N-Term GST Uncleaved
  • PREDICTED MOLECULAR WEIGHT: Mono-Isotopic Mass: 51, 319.38 daltons
    Average Mass: 51, 353.06 daltons

Properties

  • PURITY: GSH-Agarose (0.75)
  • PHYSICAL STATE: Liquid
  • BUFFER: 50 mM Tris-HCl pH 7.5, 270 mM Sucrose, 150 mM NaCl, 0.1 mM EGTA, 0.1 % 2-mercaptoethanol, 0.03 % Brij-35
  • CONCENTRATION: batch dependent
  • STORAGE CONDITIONS: Store at -70 °C. Avoid repeated freeze-thaw cycles.

Additional Info

  • NCBI OFFICIAL SYMBOL: M
  • ADDITIONAL NAMES: MERS-CoV HSZ-Cc M Protein, M Protein MERS-CoV HSZ-Cc, Membrane Protein MERS-CoV HSZ-Cc, MERS-CoV HSZ-Cc Membrane Protein
  • Protein Accession Number: ATY74387.1

Disclaimer

  • FOR RESEARCH USE ONLY
    For additional information, visit ProSci's Terms & Conditions Page.
  • Disclaimer: Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.
Powered by Bioz See more details on Bioz

CATALOG NUMBER: 20-225

  • Size: 0.1 mg
  • List Price: $535.00
Datasheet
Shipping Info

$65 Standard Overnight flat rate for as many products shipped within the United States.

$35 Dry Ice Shipment fee may be required on some items.

Note: Online orders only accepted for shipment within the USA. Click here for the list of international distributors.

Customize your order

Bulk Pricing Available

Custom Formulations: azide free, endotoxin testing & endotoxin removal.

Pair your antibody with a Lysate, Peptide, Control, & /OR Secondary Antibody.

Contact our Customer Care Team for more information

Custom Antibody Services 

Speak to one of our custom antibody specialists to discuss your next custom antibody project.

New & Featured Products
HIV-1 p24 Antibody [10A2] (biotin)
HIV-1 p24 Antibody [10A2] (biotin)

CATALOG NUMBER: PM-7371-biotin

HIV-1 p24 Antibody [9D2F6] (biotin)
HIV-1 p24 Antibody [9D2F6] (biotin)

CATALOG NUMBER: PM-7369-biotin

HIV-1 p24 Antibody [8D7E11] (biotin)
HIV-1 p24 Antibody [8D7E11] (biotin)

CATALOG NUMBER: PM-7367-biotin

Menu

  • Primary Antibodies
  • Secondary Antibodies
  • Recombinant Proteins
  • Applications & Techniques
  • Support
  • Loyalty Program
  • Blog
  • Promotions
  • About Us
  • ProSci Distributors
Custom Antibody Services

Contact

12170 Flint Place
Poway, CA 92064, USA

Phone:   +1 (888) 513-9525
Local:    +1 (858) 513-2638
Fax:       +1 (858) 513-2692

[email protected]
[email protected]

Follow

  • Facebook
  • Twitter
  • LinkedIn
  • Pinterest
  • Instagram
Copyright © 2023 ProSci Incorporated | All Rights Reserved | Terms & Conditions | Privacy Policy | Accessibility Feedback | Design by TinyFrog Technologies
We use cookies on our website to give you the most relevant experience by remembering your preferences and repeat visits. By clicking “Accept”, you consent to the use of cookies.
Accept Reject
Manage consent

Privacy Overview

This website uses cookies to improve your experience while you navigate through the website. Out of these, the cookies that are categorized as necessary are stored on your browser as they are essential for the working of basic functionalities of the website. We also use third-party cookies that help us analyze and understand how you use this website. These cookies will be stored in your browser only with your consent. You also have the option to opt-out of these cookies. But opting out of some of these cookies may affect your browsing experience.
Necessary
Always Enabled
Necessary cookies are absolutely essential for the website to function properly. These cookies ensure basic functionalities and security features of the website, anonymously.
CookieDurationDescription
cookielawinfo-checbox-analytics11 monthsThis cookie is set by GDPR Cookie Consent plugin. The cookie is used to store the user consent for the cookies in the category "Analytics".
cookielawinfo-checbox-functional11 monthsThe cookie is set by GDPR cookie consent to record the user consent for the cookies in the category "Functional".
cookielawinfo-checbox-others11 monthsThis cookie is set by GDPR Cookie Consent plugin. The cookie is used to store the user consent for the cookies in the category "Other.
cookielawinfo-checkbox-necessary11 monthsThis cookie is set by GDPR Cookie Consent plugin. The cookies is used to store the user consent for the cookies in the category "Necessary".
cookielawinfo-checkbox-performance11 monthsThis cookie is set by GDPR Cookie Consent plugin. The cookie is used to store the user consent for the cookies in the category "Performance".
viewed_cookie_policy11 monthsThe cookie is set by the GDPR Cookie Consent plugin and is used to store whether or not user has consented to the use of cookies. It does not store any personal data.
Functional
Functional cookies help to perform certain functionalities like sharing the content of the website on social media platforms, collect feedbacks, and other third-party features.
Performance
Performance cookies are used to understand and analyze the key performance indexes of the website which helps in delivering a better user experience for the visitors.
Analytics
Analytical cookies are used to understand how visitors interact with the website. These cookies help provide information on metrics the number of visitors, bounce rate, traffic source, etc.
Advertisement
Advertisement cookies are used to provide visitors with relevant ads and marketing campaigns. These cookies track visitors across websites and collect information to provide customized ads.
Others
Other uncategorized cookies are those that are being analyzed and have not been classified into a category as yet.
SAVE & ACCEPT